PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.26833s0310.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family WOX
Protein Properties Length: 255aa    MW: 28933 Da    PI: 9.6175
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.26833s0310.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.43.2e-201372357
                          --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
              Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                          +R+++tk+q++ Le+l+++  r+psa+++++++ +l    +++ ++V++WFqN++a++++
  Bostr.26833s0310.1.p 13 SRWNPTKDQITLLENLYKQgIRTPSADQIQQITGRLraygHIEGKNVFYWFQNHKARQRQ 72
                          8*****************99**************************************97 PP

2Wus_type_Homeobox115.23.2e-371174265
     Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                          +++RW+Pt++Qi++Le+lyk+G+rtP++++iq+it +L++yG+ie+kNVfyWFQN+kaR+rqkq
  Bostr.26833s0310.1.p 11 SSSRWNPTKDQITLLENLYKQGIRTPSADQIQQITGRLRAYGHIEGKNVFYWFQNHKARQRQKQ 74
                          689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.42E-12579IPR009057Homeodomain-like
PROSITE profilePS5007110.77873IPR001356Homeobox domain
SMARTSM003897.0E-51077IPR001356Homeobox domain
PfamPF000466.6E-181372IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-71372IPR009057Homeodomain-like
CDDcd000862.16E-41468No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MENVGNTGTA SSSRWNPTKD QITLLENLYK QGIRTPSADQ IQQITGRLRA YGHIEGKNVF  60
YWFQNHKARQ RQKQRQERIA YFNRLLHKTS RFFHPPPCSN VGCVSPYYLQ QVGDHHINQQ  120
GSVYTNNLLH RNNVMIPSGG YEKRTITDHK KQLSDNTRTT RMSMSSRFDR FALRDHYYYG  180
EGINVNSNGR ETLPLFPLQP LDGTNDDGTR NSSFAPGSDS PVVCFGDEGG REQPFIDFFS  240
GGSSSRFDNN GNAL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010483552.11e-165PREDICTED: WUSCHEL-related homeobox 2
SwissprotQ6X7K11e-154WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLD7MSD91e-156D7MSD9_ARALL; Predicted protein
STRINGAl_scaffold_0008_24271e-156(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69142844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-137WUSCHEL related homeobox 2